Camelia, the Perl 6 bug

IRC log for #bioclipse, 2008-10-30

| Channels | #bioclipse index | Today | | Search | Google Search | Plain-Text | summary

All times shown according to UTC.

Time Nick Message
06:38 Gpox joined #bioclipse
07:53 thomasku joined #bioclipse
08:00 egonw joined #bioclipse
08:27 CIA-52 bioclipse: egonw * r7521 /bioclipse2/trunk/plugins/net.bioclipse.cdk.busine​ss/src/net/bioclipse/cdk/business/CDKManager.java: Added not regarding bug #70
08:55 olass joined #bioclipse
09:06 edrin joined #bioclipse
09:06 edrin hi
09:06 zarah hi edrin
09:06 zarah edrin: You have new messages. Write '@messages' to read them.
09:07 edrin @messages
09:08 zarah edrin: 15 h 56 m 18 s ago, olass said need I need a pointer to where workspac eshould be refreshed
09:08 edrin olass, egonw, around?
09:18 egonw yes
09:18 olass edrin: hi
09:19 edrin hi
09:19 olass saw your email
09:19 zarah hi edrin
09:19 olass did you update so I can create binding?
09:19 edrin yes
09:19 olass what was the error?
09:19 edrin the service function never finished
09:19 olass it does here
09:19 edrin it started but never completed
09:19 olass you need to send a 93 aa protease sequence
09:19 olass I guess error handling is not tested yet...
09:20 edrin can i upload the full test client project to svn so you do not have to create it yourself?
09:20 olass what do you mean?
09:20 edrin or dont you want this code in svn?
09:20 olass what is it?
09:21 olass can I not create my own binding?
09:21 olass why use your's?
09:21 edrin yes, sure you can...
09:21 olass want to test it :-)
09:21 olass does it make a difference?
09:21 olass sure, upload yours
09:21 olass I don't mind
09:21 edrin no, i mean, i wrote a java client against it to see how easy it is to use the batch binding generator to create a project
09:21 olass in the XWS folder, you decide :-)
09:21 olass oh
09:22 olass yes, would like to see that
09:22 olass please upload it
09:23 edrin on the way
09:23 olass you at home today?
09:23 CIA-52 bioclipse: edrin_t * r7522 /xws/trunk/xws4j-hivpred-client/: Initial import.
09:23 gilleain joined #bioclipse
09:24 olass should be 99 aa in the test
09:24 olass PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGI​GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
09:24 edrin yes
09:24 olass thats the WT
09:24 olass hmm
09:24 olass ok, will test your client
09:26 CIA-52 bioclipse: edrin_t * r7523 /xws/trunk/xws4j-hivpred-client/ (93 files in 28 dirs):
09:26 edrin i took off, will go to a award ceremony event today... / i did not get a price
09:28 edrin olass: the xsb folder MUST be in the classpath of the test project! these files are required by XmLBeans
09:30 edrin egonw: did you get your certain coffee machine executing successful?
09:32 edrin olass: http://www.papernapkin.org/pastebin/view/3402/
09:32 zarah edrin's link is also http://tinyurl.com/6epa42
09:32 egonw edrin: about to implement CDK functionality
09:32 edrin ah
09:32 edrin did the problem get solved?
09:33 edrin i must leave in 10 minutes
09:33 edrin will be back tomorrow evening
09:33 egonw ok, have fun
09:34 olass bye edrin
09:34 edrin dont know, have no clue what to expect there. it's my girl, she won a price
09:34 edrin still 10 minutes left
09:34 edrin :)
09:35 edrin olass: did you see pastebin? what
09:35 olass edrin: you'll win prizes with XWS as well!
09:35 edrin s wrong?
09:35 edrin we'll see :)
09:35 olass mom, tel
09:39 olass hmmm
09:40 olass it should be fast
09:40 olass a few secs
09:40 olass something has gone wrong
09:40 olass hmm
09:40 edrin in the XWS4J: [Stanza] sent : is there an error?
09:41 olass looks good to me on firt sight...
09:41 edrin ok
09:41 olass where is the log written on server?
09:41 olass I said LOG=true
09:41 edrin maybe I killed the app yesterday night?
09:42 olass maybe
09:42 egonw it still shows up with DISCO
09:42 edrin by sending invalid sequences!?
09:42 olass will test it
09:42 edrin yes, and binding works, too...
09:42 olass hmm
09:42 olass will look at log
09:43 edrin does bc2 plugin console binding work for you now? i in fact had some errors in the lib, but i think i should have fixed them
09:43 olass have not tested
09:43 olass see no log
09:43 olass where is the log?
09:43 olass do I need to log myself?
09:43 olass hmm, guess that would be best
09:43 olass ok, will look into this in more detail
09:43 olass ttl
10:07 gilleain joined #bioclipse
11:00 edr1n joined #bioclipse
11:01 edr1n ok
11:01 edr1n so cu tomorrow
12:37 charlgren joined #bioclipse
14:15 masak joined #bioclipse
14:44 egonw joined #bioclipse
14:51 edrin joined #bioclipse
14:52 edrin I
14:52 egonw joined #bioclipse
15:01 edrin left #bioclipse
15:12 gilleain joined #bioclipse
15:13 egonw joined #bioclipse
15:19 CIA-52 bioclipse: carl_masak * r7524 /bioclipse2/trunk/plugins/net.bioclipse​.scripting.ui/src/net/bioclipse/scripti​ng/ui/views/ScriptingConsoleView.java:
15:19 CIA-52 bioclipse: [ScriptingConsoleView]
15:19 CIA-52 bioclipse: * now locks up and prevents commands from being entered while the
15:19 CIA-52 bioclipse:  js environment is busy
15:21 egonw that sounds useful
15:21 egonw ah, cool
15:22 egonw I just forgot to check if it was a normel US keyboard...
15:22 egonw but it's not :(
15:22 egonw all sorts of weird swedisch characters on this one
15:22 egonw hahahah
15:22 masak egonw: usually, the OS still allows you to switch layouts.
15:23 egonw yes, sure
15:23 masak er, the Window manager, whatever
15:24 egonw this is a really nice screen
15:25 egonw I don't have to close the console anymore :)
16:10 olass egonw: could I ask a favour from you?
16:10 olass please stop by my office and explain a little XML thingy
16:10 * olass is learning XML as we go
16:13 olass egonw?
16:14 egonw mom
16:22 olass egonw: you have time?
16:22 olass I have to run soon..
16:48 egonw olass: <mass xmlns='urn:xmpp:tmp:io-data​'>36.032207690364004</mass>
16:49 * egonw is happy to announce the first XMPP/IO-DATA CDK webservice is online :)
16:53 masak nice.
16:54 egonw ok, got to run to catch the bus now!

| Channels | #bioclipse index | Today | | Search | Google Search | Plain-Text | summary